PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G262200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TALE
Protein Properties Length: 635aa    MW: 70440 Da    PI: 5.5333
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G262200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.45.6e-094014381954
                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         Fe   ++yp+ +e+  LA+++gLt +q+++WF N R +
  Brast02G262200.1.p 401 FEHflHPYPKDSEKLMLARQTGLTRSQISNWFINARVR 438
                         664559******************************88 PP

2BELL122.22.2e-39264335172
                BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         e+qelq+k akLl +l+eVd++Yk+y++q+q+v+ssF++vag g+akpYt++Al++iSrhFrcLkdai +q+
  Brast02G262200.1.p 264 EKQELQNKMAKLLAMLDEVDRKYKHYYHQMQIVVSSFDMVAGSGAAKPYTAVALQTISRHFRCLKDAINDQV 335
                         689******************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.3E-55188333IPR006563POX domain
PfamPF075263.9E-50194331IPR006563POX domain
PROSITE profilePS5007112.357379442IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.2E-28381453IPR009057Homeodomain-like
SMARTSM003891.6E-9382446IPR001356Homeobox domain
CDDcd000861.20E-12382443No hitNo description
SuperFamilySSF466892.69E-17383449IPR009057Homeodomain-like
PfamPF059201.0E-17399438IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 635 aa     Download sequence    Send to blast
MSNYYSSPGN ERDSQTIYSP DSGSASYPVS SALGNLIYSN NASSGPYTEF NGIIQSHQNF  60
MELSGHPSEI SHHSSSPEPN MVTSLTDQHS FGPAKDMRNE MLTHFMDGAH SSGGDLIHND  120
THNSAQLEFG LLDSHNSTSV PSAPGQGLSL GLNTHILAPS YPYWSMKPDL MATQSYQSDH  180
NIMKDMQSEA SRAIRNSKYL KAAQELLDEI VSVWKIIKQN AQKDQVETGK VDGKEADGVS  240
KSEGLSSNPQ EATANAAAEI SAAEKQELQN KMAKLLAMLD EVDRKYKHYY HQMQIVVSSF  300
DMVAGSGAAK PYTAVALQTI SRHFRCLKDA INDQVNVIRK KLGEEENSSG REGKLTRLRF  360
IDQQLRQQRA FQQYGLLQQN AWRPQRGLPE NSVSILRAWL FEHFLHPYPK DSEKLMLARQ  420
TGLTRSQISN WFINARVRLW KPMIEDMYKE ETGDAELDSN SSSENVPRSK DKVASSEEKE  480
DLKCSMLAES KADFGMVDLT GAPTSFHNEV NSDDGFMNLL LKDQRPGETD GSLLHDAIAH  540
HSEENVRFMA YHLAEVGGNG NSNVSLTLGL QHTENSLSAP NTHQPGYAAV REEDIYNTTA  600
PPGVATASTD YESTNQMDQR QRFEQPPLLH DFVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A2e-16388445158Homeobox protein Meis1
4xrs_B2e-16388445158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003561342.10.0PREDICTED: BEL1-like homeodomain protein 7
TrEMBLI1GPL10.0I1GPL1_BRADI; Uncharacterized protein
STRINGBRADI1G12510.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90138131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-112BEL1-like homeodomain 6